PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011078845.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 356aa    MW: 38012.2 Da    PI: 9.0747
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011078845.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.53.3e-4270147178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +CqvegC++dls+ak y+ rhkvC +hsk+p v+v+gleqrfCqqCsrfh+l efD++krsCrrrLa+hn+rrrk+q+
  XP_011078845.1  70 RCQVEGCKVDLSDAKAYYCRHKVCGMHSKSPRVIVAGLEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNQRRRKPQP 147
                     6**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.1E-3564132IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.28268145IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-4069149IPR004333Transcription factor, SBP-box
PfamPF031103.6E-3271144IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MEKGSSSSSS SGAVADSING LKFGKKIYFE GVGSGLRPKN GGGLLPDAAP PPSPAKKGRT  60
GLVQGGQPPR CQVEGCKVDL SDAKAYYCRH KVCGMHSKSP RVIVAGLEQR FCQQCSRFHQ  120
LPEFDQGKRS CRRRLAGHNQ RRRKPQPGPL LSSRYGSLSP STFDNHSKSG GFVMDFSAYT  180
TSLTGRDSWT NTNATSERGS GNQATIGGKY QLPWQSSLQT PLPDLLQGSP TRPSYTGLGV  240
SSDECFSGVS DTSSALSLLS NQPWGSTCQS LSLGVNSFLG PDGTAIVQPP SASSSWGFKG  300
NQASNTLQEM PPDMGLAQIS QYNGDLGLAQ PNDGQYHEIE PSRGYDSSVQ HMHWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-31711441184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078845.10.0PREDICTED: squamosa promoter-binding-like protein 17
RefseqXP_011078846.10.0PREDICTED: squamosa promoter-binding-like protein 17
TrEMBLA0A075FFN01e-151A0A075FFN0_SALMI; SQUAM
STRINGVIT_08s0007g06270.t011e-133(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45712241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.11e-56squamosa promoter binding protein-like 9